PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08542A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 356aa    MW: 38782.1 Da    PI: 7.356
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08542AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-184693148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT +Ed++lv++++++G g+W++ ar  g++Rt+k+c++rw++yl
  Oropetium_20150105_08542A 46 RGPWTVDEDLILVNYIAEHGDGRWNALARAAGLKRTGKSCRLRWLNYL 93
                               89********************************************97 PP

2Myb_DNA-binding51.81.9e-1699142146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg +T++E++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
  Oropetium_20150105_08542A  99 RGDFTADEQLLILDLHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 142
                                899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9274193IPR017930Myb domain
SMARTSM007172.9E-154595IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-2945140IPR009057Homeodomain-like
PfamPF002491.6E-164693IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2247100IPR009057Homeodomain-like
CDDcd001671.70E-114893No hitNo description
PROSITE profilePS5129423.16594148IPR017930Myb domain
SMARTSM007171.5E-1498146IPR001005SANT/Myb domain
PfamPF002495.1E-1599142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-23101146IPR009057Homeodomain-like
CDDcd001671.04E-10102142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MVLQQHQQIS TGVASKTTRR PGPGSPPPPR KATXXXXXXX XXXXRRGPWT VDEDLILVNY  60
IAEHGDGRWN ALARAAGLKR TGKSCRLRWL NYLRPDVKRG DFTADEQLLI LDLHSRWGNR  120
WSKIAQQLPG RTDNEIKNYW RTRVQKHARQ LNCDVNSRQF RDAMTYLWMP RLAERAAASC  180
SHHSSQQQQH SAIAGGSCGD AHKSPCLSAL TTTTSPARGA DPAACLAANT NSYYQSPGGG  240
ASGSSSCVVP SSSSSDSSLT STESSSTAAV AAHEAEKNAH GHDDDICWAT TTQQGADLHE  300
FWTSAAAALP VEEPMSDVQD LTGWVQGFSD EGISFSSDAH SSSSLWSLDD IWRMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-24461464103MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-24461464103C-Myb DNA-Binding Domain
1msf_C3e-24461464103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284141e-121KJ728414.1 Zea mays clone pUT6719 MYB transcription factor (MYB4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979993.12e-96PREDICTED: transcription factor MYB108
TrEMBLW5EEJ82e-98W5EEJ8_WHEAT; Uncharacterized protein
STRINGSi026574m5e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-75myb domain protein 112